PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G15410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 420aa    MW: 45139.6 Da    PI: 4.7613
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G15410.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox628.8e-20158211356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k++++t+eq++ Le+ Fe+++++  e+++eLA++lg+  rqV vWFqNrRa++k
  OGLUM08G15410.1 158 KKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWK 211
                      56789************************************************9 PP

2HD-ZIP_I/II132.41.7e-42157248192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      ekkrrl++eqv++LE+sFeee+kLeperK+elar+Lg+ prqvavWFqnrRAR+ktkqlE+d+++Lk+aydal++++++L +++++Lr+++ 
  OGLUM08G15410.1 157 EKKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLEHDFDRLKAAYDALAADHHALLSDNDRLRAQVI 248
                      69**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.75E-19152215IPR009057Homeodomain-like
PROSITE profilePS5007118.236153213IPR001356Homeobox domain
SMARTSM003891.9E-19156217IPR001356Homeobox domain
PfamPF000464.3E-17158211IPR001356Homeobox domain
CDDcd000863.90E-18158214No hitNo description
Gene3DG3DSA:1.10.10.603.8E-21159220IPR009057Homeodomain-like
PRINTSPR000318.9E-6184193IPR000047Helix-turn-helix motif
PROSITE patternPS000270188211IPR017970Homeobox, conserved site
PRINTSPR000318.9E-6193209IPR000047Helix-turn-helix motif
PfamPF021831.1E-16213255IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MGFSLYPMKT STRMLWSTSF FRHKPTPSRA AAASRRRSAR LVGARACVNG RAASRSGFLG  60
FLEKGGEEGE ESMDPGRVVF DSGVARRACP GGAQMLLFGG GGSANSGGFF RGVPAAVLGM  120
DESRSSSSAA GAGAKRPFFT THEELLEEEY YDEQAPEKKR RLTAEQVQML ERSFEEENKL  180
EPERKTELAR RLGMAPRQVA VWFQNRRARW KTKQLEHDFD RLKAAYDALA ADHHALLSDN  240
DRLRAQVISL TEKLQDKETS PSSATITTAA QEVDQPDEHT EAASTTGFAT VDGALAAPPP  300
GHQQPPHKDD LVSSGGTNDD GDGGGAAVVV FDVTEGANDR LSCESAYFAD AAEAYERDCA  360
GHYALSSEEE DGGAVSDEGC SFDLPDAAAA AMFSAAGVVH HDAAADEEAQ LGSWTAWFWS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205213RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1457290.0AF145729.1 Oryza sativa homeodomain leucine zipper protein (Oshox5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650258.10.0PREDICTED: homeobox-leucine zipper protein HOX5
SwissprotQ9XH360.0HOX5_ORYSI; Homeobox-leucine zipper protein HOX5
TrEMBLA0A0E0AVB70.0A0A0E0AVB7_9ORYZ; Uncharacterized protein
STRINGORGLA08G0128600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-44homeobox 1